PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa008965
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family HD-ZIP
Protein Properties Length: 730aa    MW: 80624.1 Da    PI: 6.0994
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Lsa#S58695472PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.13.6e-1961116156
                TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
   Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                +++ +++t++q++eLe++F+++++p+ ++r+eL ++l L+  qVk+WFqN+R+++k
  Lsa008965  61 KKRYHRHTQHQIQELESFFKECPHPDDKQRKELGRRLTLEPLQVKFWFQNKRTQMK 116
                688999***********************************************998 PP

2START223.28.3e-702504701206
                HHHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEEEEECT CS
      START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kaetleviss 87 
                ela +a++elv++a+++ep+Wv ss    e +n+d++ q+f+++ +      ++ea+r+s+vv+m++ +lve+l+d++ qW++ +     +a+tlev+s+
  Lsa008965 250 ELAVAAMEELVRMAQSGEPLWVPSSdnssETLNEDDYAQTFPRGIGpkqlgLKSEASRESAVVIMNHINLVEILMDVN-QWSNVFSgivsRAMTLEVLST 348
                57899********************999999************999********************************.********************* PP

                T......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE-EE--SSXXHHH CS
      START  88 g......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwvehvdlkgrlphwl 180
                g      galq+m+ae+q++splvp R+++fvRy++q+ +g+w++vdvS+d+ ++      + R++++pSg+li++++ng+skvtw+ehv++++r +h +
  Lsa008965 349 GvagnynGALQVMTAEYQVPSPLVPtREYYFVRYCKQHADGTWAVVDVSLDNLRPSA----MSRSRRRPSGCLIQELPNGYSKVTWIEHVEVDDRAVHDI 444
                ******************************************************976....89************************************* PP

                HHHHHHHHHHHHHHHHHHHTXXXXXX CS
      START 181 lrslvksglaegaktwvatlqrqcek 206
                +r +v+sgla+ga++wv+tl+rqce+
  Lsa008965 445 YRLVVNSGLAFGARRWVSTLDRQCER 470
                ************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.0E-2242116IPR009057Homeodomain-like
SuperFamilySSF466898.36E-1943118IPR009057Homeodomain-like
PROSITE profilePS5007116.53658118IPR001356Homeobox domain
SMARTSM003895.4E-1659122IPR001356Homeobox domain
CDDcd000864.61E-1761119No hitNo description
PfamPF000467.5E-1761116IPR001356Homeobox domain
PROSITE profilePS5084848.323241473IPR002913START domain
SuperFamilySSF559611.03E-37243472No hitNo description
CDDcd088756.09E-128245469No hitNo description
SMARTSM002341.4E-67250470IPR002913START domain
PfamPF018522.2E-58251470IPR002913START domain
Gene3DG3DSA:3.30.530.205.0E-7347469IPR023393START-like domain
SuperFamilySSF559612.34E-26491722No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0008289Molecular Functionlipid binding
Sequence ? help Back to Top
Protein Sequence    Length: 730 aa     Download sequence    Send to blast
MFQPNMFESH HHHHLLDMSH KSPENQLDML RDDDYESKSG TDIMEAPSGD DQDPNQRPNK  60
KKRYHRHTQH QIQELESFFK ECPHPDDKQR KELGRRLTLE PLQVKFWFQN KRTQMKAQHE  120
RHENSSLRNE NEKLRMENIR YKEALTNATC PNCGGPAAIG EMSFDEQHLR IENARLREEI  180
DRISGIAAKY VGKPMLSYPN LTQNGPPRSL DLPIASFSPQ PVMVDDMFGT SSLLRSVSGP  240
SEADKPVIIE LAVAAMEELV RMAQSGEPLW VPSSDNSSET LNEDDYAQTF PRGIGPKQLG  300
LKSEASRESA VVIMNHINLV EILMDVNQWS NVFSGIVSRA MTLEVLSTGV AGNYNGALQV  360
MTAEYQVPSP LVPTREYYFV RYCKQHADGT WAVVDVSLDN LRPSAMSRSR RRPSGCLIQE  420
LPNGYSKVTW IEHVEVDDRA VHDIYRLVVN SGLAFGARRW VSTLDRQCER LASAMANNIP  480
AGDVGVITTL EGRKSMLKLA ERMVLSFCSG VGASTTHTWT TLSGSGADDV RVMTRKSVDD  540
PGRPPGIVLS AATSFWIPVP PKRVFDFLRD ENSRSEWDIL SNGGLVQEMA HIANGRDPGN  600
CVSLLRVNSA NSSQGNMLIL QESSNDSTGS YVIYAPVDIA AMNVVLSGGD PDYVALLPSG  660
FAILPDGPGK HQGGRIPEVG DGGSLLTVAF QILVDSVPTA KLSLGSVATV NSLIKCTVER  720
IKAAVAPDNP
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011086174.10.0PREDICTED: homeobox-leucine zipper protein MERISTEM L1-like
SwissprotQ93V990.0PDF2_ARATH; Homeobox-leucine zipper protein PROTODERMAL FACTOR 2
TrEMBLA0A118K0F50.0A0A118K0F5_CYNCS; Homeodomain-containing protein
STRINGVIT_10s0116g00680.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G04890.10.0protodermal factor 2